PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026694m
Common NameCARUB_v10026694mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 351aa    MW: 39270.9 Da    PI: 5.0449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026694mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ +++ g+ R++k+c++rw +yl
  Carubv10026694m 14 RGRWTAEEDEILTNYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding54.92.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E+e +v+++ +lG++ W++Ia +++ gRt++++k++w+++l
  Carubv10026694m  67 RGNITADEEETIVKLHSLLGNR-WSLIATHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.489961IPR017930Myb domain
SuperFamilySSF466895.14E-2811108IPR009057Homeodomain-like
SMARTSM007171.8E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-221568IPR009057Homeodomain-like
CDDcd001671.50E-81661No hitNo description
PROSITE profilePS5129426.49362116IPR017930Myb domain
SMARTSM007173.1E-1666114IPR001005SANT/Myb domain
PfamPF002493.3E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2469116IPR009057Homeodomain-like
CDDcd001671.69E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTAE EDEILTNYIQ TNGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRRDLKRGNI TADEEETIVK LHSLLGNRWS LIATHLPGRT DNEIKNYWNS HLSRKIYAFA  120
AVSGDDHNLV IDNMLLKKAC SSSTGAKNNT KTTKKKKKGR TSRSSMKKHK QMVTAASQSS  180
VPKPKELESE ISDGGQNGNF EGESLGPYEW LDGELERLLS SCVWECTSEE VVAGVDDEKM  240
CESGDNSSCC VGMFEEEQGS VETKQLGHTR ITKVDDHDMM KVEKEREGSV LSSNSIENDD  300
KDWWLGLCNS SEVGFGIDEE LLNWEFQGNS LTCPSDDLWD LSDIGEITLE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-221211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719770.0AF371977.1 Arabidopsis thaliana putative transcription factor (At5g49330) mRNA, complete cds.
GenBankAY5196340.0AY519634.1 Arabidopsis thaliana MYB transcription factor (At5g49330) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280725.10.0hypothetical protein CARUB_v10026694mg
SwissprotO222648e-76MYB12_ARATH; Transcription factor MYB12
TrEMBLR0GR250.0R0GR25_9BRAS; Uncharacterized protein
STRINGscaffold_801313.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.10.0myb domain protein 111